PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TCP
Protein Properties Length: 382aa    MW: 39714.1 Da    PI: 6.6878
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234310.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.24.2e-3685155373
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                     ++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti WLl+qa+pai ++tgt++++a ++
  XP_008234310.1  85 AAKRSSKDRHTKVEGRGRRIRMPATCAARIFQLTRELGHKSDGETIRWLLEQAEPAIMQATGTGTIPAIAV 155
                     5799***********************************************************99988544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-2989158IPR005333Transcription factor, TCP
PROSITE profilePS5136926.75490144IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEPNQRQSLE ESNELEQQSN SSSNDNTTSA SDPSVADPPE KIFPLTAPTM KEELTDTVQE  60
LDEGSLPMGL IQVPVPTSSE KQVVAAKRSS KDRHTKVEGR GRRIRMPATC AARIFQLTRE  120
LGHKSDGETI RWLLEQAEPA IMQATGTGTI PAIAVSVGGT LKIPTTSPAR PNGEITEIPR  180
KRRKRGSNSE FVDVHEQSSV SSGLAPMSYG GGGGGGGAHG LVPMWQVGAT GAAGPFFMFP  240
NNGAVNPNQP QLWAVPAADA ATPIFNFQAR PISNFLSAFQ PGVHVVGGDV QLQASSGSIS  300
SGATSGSGGS CSSSLGPSLG SASGTRANKN TISTGSGTGA SAAAAAASAT TTQMLRDFSL  360
EIYDKRELQF MGANSQTPYS KP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234310.10.0PREDICTED: transcription factor TCP19
SwissprotQ9LT892e-63TCP19_ARATH; Transcription factor TCP19
TrEMBLW9RV441e-135W9RV44_9R
STRINGGLYMA20G29330.21e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.27e-64TCP family protein